General Information

  • ID:  hor006882
  • Uniprot ID:  P02761??21-181)
  • Protein name:  Major urinary protein
  • Gene name:  Epo
  • Organism:  Rattus norvegicus
  • Family:  Lipocalin family
  • Source:  Animal
  • Expression:  Abundant in the urine of adult male rats but absent from that of females.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat)
  • GO MF:  NA
  • GO BP:  GO:0005549 odorant binding; GO:0005009 insulin receptor activity; GO:0005550 pheromone binding; GO:0036094 small molecule binding
  • GO CC:  GO:0009060 aerobic respiration; GO:0071396 cellular response to lipid; GO:0006112 energy reserve metabolic process; GO:0042593 glucose homeostasis; GO:0031649 heat generation; GO:0045475 locomotor rhythm; GO:0045892 negative regulation of DNA-templated transcription; GO:0045721 negative regulation of gluconeogenesis; GO:0061179 negative regulation of insulin secretion involved in cellular response to glucose stimulus; GO:0010888 negative regulation of lipid storage; GO:0010628 positive regulation of gene expression; GO:0010907 positive regulation of glucose metabolic process; GO:0045834 positive regulation of lipid metabolic process; GO:0007005 mitochondrion organization; GO:0051055 negative regulation of lipid biosynthetic process; GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

Sequence Information

  • Sequence:  EASSTRGNLDVAKLNGDWFSIVVASNKREKIEENGSMRVFMQHIDVLENSLGFKFRIKENGECRELYLVAYKTPEDGEYFVEYDGGNTFTILKTDYDRYVMFHLINFKNGETFQLMVLYGRTKDLSSDIKEKFAKLCEAHGITRDNIIDLTKTDRCLQARG
  • Length:  161
  • Propeptide:  MKLLLLLLCLGLTLVCGHAEEASSTRGNLDVAKLNGDWFSIVVASNKREKIEENGSMRVFMQHIDVLENSLGFKFRIKENGECRELYLVAYKTPEDGEYFVEYDGGNTFTILKTDYDRYVMFHLINFKNGETFQLMVLYGRTKDLSSDIKEKFAKLCEAHGITRDNIIDLTKTDRCLQARG
  • Signal peptide:  MKLLLLLLCLGLTLVCGHA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA